ANKMY2 (NM_020319) Human Recombinant Protein

SKU
TP306770
Recombinant protein of human ankyrin repeat and MYND domain containing 2 (ANKMY2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206770 protein sequence
Red=Cloning site Green=Tags(s)

MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLDMCKLLLRHGA
DVNCHQHEHGYTALMFAALSGNKDITWVMLEAGAETDVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRER
LDYYTKPQGLDKEPKLPPKLAGPLHKIITTTNLHPVKIVMLVNENPLLTEEAALNKCYRVMDLICEKCMK
QRDMNEVLAMKMHYISCIFQKCINFLKDGENKLDTLIKSLLKGRASDGFPVYQEKIIRESIRKFPYCEAT
LLQQLVRSIAPVEIGSDPTAFSVLTQAITGQVGFVDVEFCTTCGEKGASKRCSVCKMVIYCDQTCQKTHW
FTHKKICKNLKDIYEKQQLEAAKEKRQEENHGKLDVNSNCVNEEQPEAEVGISQKDSNPEDSGEGKKESL
ESEAELEGLQDAPAGPQVSEE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_064715
Locus ID 57037
UniProt ID Q8IV38
Cytogenetics 7p21.1
RefSeq Size 2567
RefSeq ORF 1323
Synonyms ZMYND20
Summary May be involved in the trafficking of signaling proteins to the cilia.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ANKMY2 (NM_020319) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306770 ANKMY2 MS Standard C13 and N15-labeled recombinant protein (NP_064715) 10 ug
$3,255.00
LC412559 ANKMY2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412559 Transient overexpression lysate of ankyrin repeat and MYND domain containing 2 (ANKMY2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.