ANKMY2 (NM_020319) Human Mass Spec Standard

SKU
PH306770
ANKMY2 MS Standard C13 and N15-labeled recombinant protein (NP_064715)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206770]
Predicted MW 49.3 kDa
Protein Sequence
Protein Sequence
>RC206770 protein sequence
Red=Cloning site Green=Tags(s)

MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLDMCKLLLRHGA
DVNCHQHEHGYTALMFAALSGNKDITWVMLEAGAETDVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRER
LDYYTKPQGLDKEPKLPPKLAGPLHKIITTTNLHPVKIVMLVNENPLLTEEAALNKCYRVMDLICEKCMK
QRDMNEVLAMKMHYISCIFQKCINFLKDGENKLDTLIKSLLKGRASDGFPVYQEKIIRESIRKFPYCEAT
LLQQLVRSIAPVEIGSDPTAFSVLTQAITGQVGFVDVEFCTTCGEKGASKRCSVCKMVIYCDQTCQKTHW
FTHKKICKNLKDIYEKQQLEAAKEKRQEENHGKLDVNSNCVNEEQPEAEVGISQKDSNPEDSGEGKKESL
ESEAELEGLQDAPAGPQVSEE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064715
RefSeq Size 2567
RefSeq ORF 1323
Synonyms ZMYND20
Locus ID 57037
UniProt ID Q8IV38
Cytogenetics 7p21.1
Summary May be involved in the trafficking of signaling proteins to the cilia.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ANKMY2 (NM_020319) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412559 ANKMY2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412559 Transient overexpression lysate of ankyrin repeat and MYND domain containing 2 (ANKMY2) 100 ug
$436.00
TP306770 Recombinant protein of human ankyrin repeat and MYND domain containing 2 (ANKMY2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.