CD5 (NM_014207) Human Recombinant Protein
CAT#: TP306494
Recombinant protein of human CD5 molecule (CD5), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206494 protein sequence
Red=Cloning site Green=Tags(s) MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQ WEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTP PTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFL KHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVG GSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQC HELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGP TGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSRLSAYPALEGVLHRSSMQPDNSSDSDYDLH GAQRL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055022 |
Locus ID | 921 |
UniProt ID | P06127 |
Cytogenetics | 11q12.2 |
Refseq Size | 3180 |
Refseq ORF | 1485 |
Synonyms | LEU1; T1 |
Summary | This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2016] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Hematopoietic cell lineage |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415443 | CD5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415443 | Transient overexpression lysate of CD5 molecule (CD5) |
USD 436.00 |
|
PH306494 | CD5 MS Standard C13 and N15-labeled recombinant protein (NP_055022) |
USD 3,255.00 |
|
TP700241 | Purified Recombinant protein of human CD5 molecule (CD5), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 867.00 |
|
TP724006 | Human CD5 Protein, His Tag |
USD 520.00 |
{0} Product Review(s)
Be the first one to submit a review