OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD5 (NM_014207) Human Mass Spec Standard

Be the first to review this product
SKU
PH306494
CD5 MS Standard C13 and N15-labeled recombinant protein (NP_055022)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA802427 CD5 mouse monoclonal antibody, clone OTI10F4 (formerly 10F4) 100 ul
$447.00
LY415443 Transient overexpression lysate of CD5 molecule (CD5) (as WB positive control) 100 ug
$436.00

Other products for "CD5 or NM_014207"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206494
Predicted MW 54.6 kDa
Protein Sequence
Protein Sequence
>RC206494 protein sequence
Red=Cloning site Green=Tags(s)

MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQ
WEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTP
PTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFL
KHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVG
GSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQC
HELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGP
TGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSRLSAYPALEGVLHRSSMQPDNSSDSDYDLH
GAQRL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055022
RefSeq Size 3180
RefSeq ORF 1485
Synonyms LEU1; T1
Locus ID 921
UniProt ID P06127
Cytogenetics 11q12.2
Summary This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Oct 2016
Protein Families Druggable Genome, Transmembrane
Protein Pathways Hematopoietic cell lineage
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD5" proteins (5)
SKU Description Size Price
LC415443 Lyophilized CD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415443 Transient overexpression lysate of CD5 molecule (CD5) (as WB positive control) 100 ug
$436.00
TP306494 Recombinant protein of human CD5 molecule (CD5), 20 µg 20 ug
$737.00
TP700241 Purified Recombinant protein of human CD5 molecule (CD5), with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP724006 Recombinant human CD5 protein with C-terminal 6×His tag 100 ug
$700.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products