CaMKK (CAMKK1) (NM_172207) Human Recombinant Protein

SKU
TP306389
Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206389 protein sequence
Red=Cloning site Green=Tags(s)

MEGGPAVCCQDPRAELVERVAAIDVTHLEEADGGPEPTRNGVDPPPRARAASVIPGSTSRLLPARPSLSA
RKLSLQERPAGSYLEAQAGPYATGPASHISPRAWRRPTIESHHVAISDAEDCVQLNQYKLQSEIGKGAYG
VVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAAQGGPAKQLLPLERVYQEIAILKKLDHVN
VVKLIEVLDDPAEDNLYLALQNQAQNIQLDSTNIAKPHSLLPSEQQDSGSTWAARSVFDLLRKGPVMEVP
CDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAG
TPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILALHRKIKNEPVVFPEGPEISEEL
KDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSEEEHCSVVEVTEEEVKNSVRLIPSWTTVILVKS
MLRKRSFGNPFEPQARREERSMSAPGNLLV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 57.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_757344
Locus ID 84254
UniProt ID Q8N5S9
Cytogenetics 17p13.2
RefSeq Size 2535
RefSeq ORF 1560
Synonyms CAMKKA
Summary The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade. Three transcript variants encoding two distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Adipocytokine signaling pathway
Write Your Own Review
You're reviewing:CaMKK (CAMKK1) (NM_172207) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306389 CAMKK1 MS Standard C13 and N15-labeled recombinant protein (NP_757344) 10 ug
$3,255.00
PH308102 CAMKK1 MS Standard C13 and N15-labeled recombinant protein (NP_115670) 10 ug
$3,255.00
PH318931 CAMKK1 MS Standard C13 and N15-labeled recombinant protein (NP_757343) 10 ug
$3,255.00
LC406737 CAMKK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406738 CAMKK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410237 CAMKK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406737 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 2 100 ug
$665.00
LY406738 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 3 100 ug
$436.00
LY410237 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 1 100 ug
$436.00
TP308102 Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318931 Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.