CaMKK (CAMKK1) (NM_172207) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC206389] |
Predicted MW | 57.5 kDa |
Protein Sequence |
Protein Sequence
>RC206389 protein sequence
Red=Cloning site Green=Tags(s) MEGGPAVCCQDPRAELVERVAAIDVTHLEEADGGPEPTRNGVDPPPRARAASVIPGSTSRLLPARPSLSA RKLSLQERPAGSYLEAQAGPYATGPASHISPRAWRRPTIESHHVAISDAEDCVQLNQYKLQSEIGKGAYG VVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAAQGGPAKQLLPLERVYQEIAILKKLDHVN VVKLIEVLDDPAEDNLYLALQNQAQNIQLDSTNIAKPHSLLPSEQQDSGSTWAARSVFDLLRKGPVMEVP CDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAG TPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILALHRKIKNEPVVFPEGPEISEEL KDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSEEEHCSVVEVTEEEVKNSVRLIPSWTTVILVKS MLRKRSFGNPFEPQARREERSMSAPGNLLV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_757344 |
RefSeq Size | 2535 |
RefSeq ORF | 1560 |
Synonyms | CAMKKA |
Locus ID | 84254 |
UniProt ID | Q8N5S9 |
Cytogenetics | 17p13.2 |
Summary | The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade. Three transcript variants encoding two distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Adipocytokine signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH308102 | CAMKK1 MS Standard C13 and N15-labeled recombinant protein (NP_115670) | 10 ug |
$3,255.00
|
|
PH318931 | CAMKK1 MS Standard C13 and N15-labeled recombinant protein (NP_757343) | 10 ug |
$3,255.00
|
|
LC406737 | CAMKK1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC406738 | CAMKK1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC410237 | CAMKK1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY406737 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 2 | 100 ug |
$665.00
|
|
LY406738 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 3 | 100 ug |
$436.00
|
|
LY410237 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 1 | 100 ug |
$436.00
|
|
TP306389 | Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP308102 | Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP318931 | Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.