CCDC68 (NM_025214) Human Recombinant Protein

SKU
TP306244
Recombinant protein of human coiled-coil domain containing 68 (CCDC68), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206244 protein sequence
Red=Cloning site Green=Tags(s)

MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHC
GNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMNKENEVLKIKLQASREAGAAALRNVAQRLFENYQT
QSEEVRKKQEDSKQLLQVNKLEKEQKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKL
SLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSVIQEMEGLKNNLKEQDKRIEN
LREKVNILEAQNKELKTQVALSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_079490
Locus ID 80323
UniProt ID Q9H2F9
Cytogenetics 18q21.2
RefSeq Size 4136
RefSeq ORF 1005
Synonyms SE57-1
Summary Centriolar protein required for centriole subdistal appendage assembly and microtubule anchoring in interphase cells (PubMed:28422092). Together with CCDC120, cooperate with subdistal appendage components ODF2, NIN and CEP170 for hierarchical subdistal appendage assembly (PubMed:28422092).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CCDC68 (NM_025214) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306244 CCDC68 MS Standard C13 and N15-labeled recombinant protein (NP_079490) 10 ug
$3,255.00
LC410838 CCDC68 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428372 CCDC68 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410838 Transient overexpression lysate of coiled-coil domain containing 68 (CCDC68), transcript variant 1 100 ug
$436.00
LY428372 Transient overexpression lysate of coiled-coil domain containing 68 (CCDC68), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.