CCDC68 (NM_025214) Human Mass Spec Standard

SKU
PH306244
CCDC68 MS Standard C13 and N15-labeled recombinant protein (NP_079490)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206244]
Predicted MW 38.9 kDa
Protein Sequence
Protein Sequence
>RC206244 protein sequence
Red=Cloning site Green=Tags(s)

MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHC
GNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMNKENEVLKIKLQASREAGAAALRNVAQRLFENYQT
QSEEVRKKQEDSKQLLQVNKLEKEQKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKL
SLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSVIQEMEGLKNNLKEQDKRIEN
LREKVNILEAQNKELKTQVALSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079490
RefSeq Size 4136
RefSeq ORF 1005
Synonyms SE57-1
Locus ID 80323
UniProt ID Q9H2F9
Cytogenetics 18q21.2
Summary Centriolar protein required for centriole subdistal appendage assembly and microtubule anchoring in interphase cells (PubMed:28422092). Together with CCDC120, cooperate with subdistal appendage components ODF2, NIN and CEP170 for hierarchical subdistal appendage assembly (PubMed:28422092).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CCDC68 (NM_025214) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410838 CCDC68 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428372 CCDC68 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410838 Transient overexpression lysate of coiled-coil domain containing 68 (CCDC68), transcript variant 1 100 ug
$436.00
LY428372 Transient overexpression lysate of coiled-coil domain containing 68 (CCDC68), transcript variant 2 100 ug
$436.00
TP306244 Recombinant protein of human coiled-coil domain containing 68 (CCDC68), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.