POGLUT3 (NM_153705) Human Recombinant Protein

SKU
TP306171
Recombinant protein of human KDEL (Lys-Asp-Glu-Leu) containing 2 (KDELC2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206171 protein sequence
Red=Cloning site Green=Tags(s)

MRRLPRALLLQLRLALLVAAGAPEVLVSAPRSLVWGPGLQAAVVLPVRYFYLQAVNSEGQNLTRSPAGET
PFKVVVKSLSPKELVRIHVPKPLDRNDGTFLMRYRMYETVDEGLKIEVLYGDEHVAQSPYILKGPVYHEY
CECPEDPQAWQKTLSCPTKEPQIAKDFASFPSINLQQMLKEVPKRFGDERGAIVHYTILNNHVYRRSLGK
YTDFKMFSDEILLSLTRKVLLPDLEFYVNLGDWPLEHRKVNGTPSPIPIISWCGSLDSRDVVLPTYDITH
SMLEAMRGVTNDLLSIQGNTGPSWINKTERAFFRGRDSLEERLQLVQLSKENPQLLDAGITGYFFFQEKE
KELGKAKLMGFFDFFKYKYQVNVDGTVAAYRYPYLMLGDSLVLKQDSPYYEHFYMALEPWKHYVPIKRNL
SDLLEKVKWAKENDEEAKKIAKEGQLMARDLLQPHRLYCYYYQVLQKYAERQSSKPEVRDGMELVPQPED
STAICQCHRKKPSREEL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 58.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_714916
Locus ID 143888
UniProt ID Q7Z4H8
Cytogenetics 11q22.3
RefSeq Size 4311
RefSeq ORF 1521
Synonyms KDELC2
Summary Protein glucosyltransferase that catalyzes the transfer of glucose from UDP-glucose to a serine residue within the consensus sequence peptide C-X-N-T-X-G-S-F-X-C (PubMed:30127001). Can also catalyze the transfer of xylose from UDP-xylose but less efficiently (PubMed:30127001). Specifically targets extracellular EGF repeats of proteins such as NOTCH1 and NOTCH3 (PubMed:30127001). May regulate the transport of NOTCH1 and NOTCH3 to the plasma membrane and thereby the Notch signaling pathway (PubMed:30127001).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:POGLUT3 (NM_153705) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306171 KDELC2 MS Standard C13 and N15-labeled recombinant protein (NP_714916) 10 ug
$3,255.00
LC406972 KDELC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406972 Transient overexpression lysate of KDEL (Lys-Asp-Glu-Leu) containing 2 (KDELC2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.