POGLUT3 (NM_153705) Human Mass Spec Standard

SKU
PH306171
KDELC2 MS Standard C13 and N15-labeled recombinant protein (NP_714916)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206171]
Predicted MW 58.5 kDa
Protein Sequence
Protein Sequence
>RC206171 protein sequence
Red=Cloning site Green=Tags(s)

MRRLPRALLLQLRLALLVAAGAPEVLVSAPRSLVWGPGLQAAVVLPVRYFYLQAVNSEGQNLTRSPAGET
PFKVVVKSLSPKELVRIHVPKPLDRNDGTFLMRYRMYETVDEGLKIEVLYGDEHVAQSPYILKGPVYHEY
CECPEDPQAWQKTLSCPTKEPQIAKDFASFPSINLQQMLKEVPKRFGDERGAIVHYTILNNHVYRRSLGK
YTDFKMFSDEILLSLTRKVLLPDLEFYVNLGDWPLEHRKVNGTPSPIPIISWCGSLDSRDVVLPTYDITH
SMLEAMRGVTNDLLSIQGNTGPSWINKTERAFFRGRDSLEERLQLVQLSKENPQLLDAGITGYFFFQEKE
KELGKAKLMGFFDFFKYKYQVNVDGTVAAYRYPYLMLGDSLVLKQDSPYYEHFYMALEPWKHYVPIKRNL
SDLLEKVKWAKENDEEAKKIAKEGQLMARDLLQPHRLYCYYYQVLQKYAERQSSKPEVRDGMELVPQPED
STAICQCHRKKPSREEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_714916
RefSeq Size 4311
RefSeq ORF 1521
Synonyms KDELC2
Locus ID 143888
UniProt ID Q7Z4H8
Cytogenetics 11q22.3
Summary Protein glucosyltransferase that catalyzes the transfer of glucose from UDP-glucose to a serine residue within the consensus sequence peptide C-X-N-T-X-G-S-F-X-C (PubMed:30127001). Can also catalyze the transfer of xylose from UDP-xylose but less efficiently (PubMed:30127001). Specifically targets extracellular EGF repeats of proteins such as NOTCH1 and NOTCH3 (PubMed:30127001). May regulate the transport of NOTCH1 and NOTCH3 to the plasma membrane and thereby the Notch signaling pathway (PubMed:30127001).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:POGLUT3 (NM_153705) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406972 KDELC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406972 Transient overexpression lysate of KDEL (Lys-Asp-Glu-Leu) containing 2 (KDELC2) 100 ug
$436.00
TP306171 Recombinant protein of human KDEL (Lys-Asp-Glu-Leu) containing 2 (KDELC2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.