beta COP (COPB1) (NM_016451) Human Recombinant Protein

SKU
TP306009
Recombinant protein of human coatomer protein complex, subunit beta 1 (COPB1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206009 protein sequence
Red=Cloning site Green=Tags(s)

MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQ
DHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAI
RACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLS
TCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKA
AAQCYIDLIIKESDNNVKLIVLDRLIELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSS
RNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLSDNNEAAAADV
LEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVE
SEIKKEAGELKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEDRPPLRGFLLDGDFFVAASLATT
LTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDI
FNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNT
QRKEAADPLASKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVE
KPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEF
RQMWAEFEWENKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVS
IEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 107 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057535
Locus ID 1315
UniProt ID P53618
Cytogenetics 11p15.2
RefSeq Size 3490
RefSeq ORF 2859
Synonyms BARMACS; COPB
Summary This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]
Write Your Own Review
You're reviewing:beta COP (COPB1) (NM_016451) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306009 COPB1 MS Standard C13 and N15-labeled recombinant protein (NP_057535) 10 ug
$3,255.00
PH327856 COPB1 MS Standard C13 and N15-labeled recombinant protein (NP_001137533) 10 ug
$3,255.00
LC402554 COPB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428488 COPB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428489 COPB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402554 Transient overexpression lysate of coatomer protein complex, subunit beta 1 (COPB1), transcript variant 1 100 ug
$436.00
LY428488 Transient overexpression lysate of coatomer protein complex, subunit beta 1 (COPB1), transcript variant 2 100 ug
$665.00
LY428489 Transient overexpression lysate of coatomer protein complex, subunit beta 1 (COPB1), transcript variant 3 100 ug
$665.00
TP327856 Recombinant protein of human coatomer protein complex, subunit beta 1 (COPB1), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.