HMG1 (HMGB1) (NM_002128) Human Recombinant Protein
SKU
TP305918
Recombinant protein of human high-mobility group box 1 (HMGB1), 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC205918 protein sequence
Red=Cloning site Green=Tags(s) MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR YEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD KQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEE DDDDE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002119 |
Locus ID | 3146 |
UniProt ID | P09429 |
Cytogenetics | 13q12.3 |
RefSeq Size | 3428 |
RefSeq ORF | 645 |
Synonyms | HMG-1; HMG1; HMG3; SBP-1 |
Summary | This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Base excision repair |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH305918 | HMGB1 MS Standard C13 and N15-labeled recombinant protein (NP_002119) | 10 ug |
$3,255.00
|
|
LC400775 | HMGB1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400775 | Transient overexpression lysate of high-mobility group box 1 (HMGB1) | 100 ug |
$436.00
|
|
TP720309 | Recombinant protein of human high-mobility group box 1 (HMGB1) | 10 ug |
$300.00
|
|
TP721133 | Purified recombinant protein of Human high mobility group box 1 (HMGB1) | 10 ug |
$265.00
|
|
TP721198 | Purified recombinant protein of Human high mobility group box 1 (HMGB1) | 10 ug |
$265.00
|
|
TP762387 | Purified recombinant protein of Human high mobility group box 1 (HMGB1), full length, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$249.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.