Epiphycan (EPYC) (NM_004950) Human Recombinant Protein
SKU
TP305900
Recombinant protein of human epiphycan (EPYC), 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC205900 representing NM_004950
Red=Cloning site Green=Tags(s) MKTLAGLVLGLVIFDAAVTAPTLESINYDSETYDATLEDLDNLYNYENIPVGKVEIEIATVMPSGNRELL TPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPP LPKNTAYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELVLRDNKIRQLPELP TTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCN VKNLTYIRKALEDIRLDGNPINLSKTPQAYMCLPRLPVGSLV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_004941 |
Locus ID | 1833 |
UniProt ID | Q99645 |
Cytogenetics | 12q21.33 |
RefSeq Size | 1594 |
RefSeq ORF | 966 |
Synonyms | DSPG3; Pg-Lb; PGLB; SLRR3B |
Summary | Dermatan sulfate proteoglycan 3 is a member of the small leucine-rich repeat proteoglycan family. This gene is composed of seven exons. It regulates fibrillogenesis by interacting with collagen fibrils and other extracellular matrix proteins. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH305900 | EPYC MS Standard C13 and N15-labeled recombinant protein (NP_004941) | 10 ug |
$3,255.00
|
|
LC417637 | EPYC HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY417637 | Transient overexpression lysate of epiphycan (EPYC) | 100 ug |
$436.00
|
|
TP701052 | Purified recombinant protein of Human epiphycan (EPYC), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug | 50 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.