Epiphycan (EPYC) (NM_004950) Human Recombinant Protein

SKU
TP305900
Recombinant protein of human epiphycan (EPYC), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205900 representing NM_004950
Red=Cloning site Green=Tags(s)

MKTLAGLVLGLVIFDAAVTAPTLESINYDSETYDATLEDLDNLYNYENIPVGKVEIEIATVMPSGNRELL
TPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPP
LPKNTAYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELVLRDNKIRQLPELP
TTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCN
VKNLTYIRKALEDIRLDGNPINLSKTPQAYMCLPRLPVGSLV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004941
Locus ID 1833
UniProt ID Q99645
Cytogenetics 12q21.33
RefSeq Size 1594
RefSeq ORF 966
Synonyms DSPG3; Pg-Lb; PGLB; SLRR3B
Summary Dermatan sulfate proteoglycan 3 is a member of the small leucine-rich repeat proteoglycan family. This gene is composed of seven exons. It regulates fibrillogenesis by interacting with collagen fibrils and other extracellular matrix proteins. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:Epiphycan (EPYC) (NM_004950) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305900 EPYC MS Standard C13 and N15-labeled recombinant protein (NP_004941) 10 ug
$3,255.00
LC417637 EPYC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417637 Transient overexpression lysate of epiphycan (EPYC) 100 ug
$436.00
TP701052 Purified recombinant protein of Human epiphycan (EPYC), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.