Epiphycan (EPYC) (NM_004950) Human Mass Spec Standard

SKU
PH305900
EPYC MS Standard C13 and N15-labeled recombinant protein (NP_004941)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205900]
Predicted MW 36.58 kDa
Protein Sequence
Protein Sequence
>RC205900 representing NM_004950
Red=Cloning site Green=Tags(s)

MKTLAGLVLGLVIFDAAVTAPTLESINYDSETYDATLEDLDNLYNYENIPVGKVEIEIATVMPSGNRELL
TPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPP
LPKNTAYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELVLRDNKIRQLPELP
TTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCN
VKNLTYIRKALEDIRLDGNPINLSKTPQAYMCLPRLPVGSLV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004941
RefSeq Size 1594
RefSeq ORF 966
Synonyms DSPG3; Pg-Lb; PGLB; SLRR3B
Locus ID 1833
UniProt ID Q99645
Cytogenetics 12q21.33
Summary Dermatan sulfate proteoglycan 3 is a member of the small leucine-rich repeat proteoglycan family. This gene is composed of seven exons. It regulates fibrillogenesis by interacting with collagen fibrils and other extracellular matrix proteins. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:Epiphycan (EPYC) (NM_004950) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417637 EPYC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417637 Transient overexpression lysate of epiphycan (EPYC) 100 ug
$436.00
TP305900 Recombinant protein of human epiphycan (EPYC), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP701052 Purified recombinant protein of Human epiphycan (EPYC), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.