IGF2BP2 (NM_006548) Human Recombinant Protein
CAT#: TP305673
Recombinant protein of human insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2), transcript variant 1
USD 447.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205673 protein sequence
Red=Cloning site Green=Tags(s) MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEV DYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLS GHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGK EGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILA HNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFEN DMLAVNQQANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPHH HSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQGR IFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRI IGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 65.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006539 |
Locus ID | 10644 |
UniProt ID | Q9Y6M1 |
Cytogenetics | 3q27.2 |
Refseq Size | 3676 |
Refseq ORF | 1794 |
Synonyms | IMP-2; IMP2; VICKZ2 |
Summary | This gene encodes a protein that binds the 5' UTR of insulin-like growth factor 2 (IGF2) mRNA and regulates its translation. It plays an important role in metabolism and variation in this gene is associated with susceptibility to diabetes. Alternative splicing and promoter usage results in multiple transcript variants. Related pseudogenes are found on several chromosomes. [provided by RefSeq, Sep 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401961 | IGF2BP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423450 | IGF2BP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY401961 | Transient overexpression lysate of insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2), transcript variant 1 |
USD 436.00 |
|
LY423450 | Transient overexpression lysate of insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2), transcript variant 2 |
USD 665.00 |
|
PH305673 | IGF2BP2 MS Standard C13 and N15-labeled recombinant protein (NP_006539) |
USD 3,255.00 |
|
TP720863 | Purified recombinant protein of Human insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review