IGF2BP2 (NM_006548) Human Recombinant Protein

SKU
TP305673
Recombinant protein of human insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205673 protein sequence
Red=Cloning site Green=Tags(s)

MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEV
DYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLS
GHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGK
EGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILA
HNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFEN
DMLAVNQQANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPHH
HSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQGR
IFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRI
IGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 65.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_006539
Locus ID 10644
UniProt ID Q9Y6M1
Cytogenetics 3q27.2
RefSeq Size 3676
RefSeq ORF 1794
Synonyms IMP-2; IMP2; VICKZ2
Summary This gene encodes a protein that binds the 5' UTR of insulin-like growth factor 2 (IGF2) mRNA and regulates its translation. It plays an important role in metabolism and variation in this gene is associated with susceptibility to diabetes. Alternative splicing and promoter usage results in multiple transcript variants. Related pseudogenes are found on several chromosomes. [provided by RefSeq, Sep 2016]
Write Your Own Review
You're reviewing:IGF2BP2 (NM_006548) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305673 IGF2BP2 MS Standard C13 and N15-labeled recombinant protein (NP_006539) 10 ug
$3,255.00
LC401961 IGF2BP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423450 IGF2BP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401961 Transient overexpression lysate of insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2), transcript variant 1 100 ug
$436.00
LY423450 Transient overexpression lysate of insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2), transcript variant 2 100 ug
$665.00
TP720863 Purified recombinant protein of Human insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.