IGF2BP2 (NM_006548) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
| Product Data | |
| Tag | C-Myc/DDK |
|---|---|
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | [RC205673] |
| Predicted MW | 66 kDa |
| Protein Sequence |
Protein Sequence
>RC205673 protein sequence
Red=Cloning site Green=Tags(s) MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEV DYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLS GHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGK EGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILA HNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFEN DMLAVNQQANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPHH HSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQGR IFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRI IGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
| Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Shipping | Dry Ice |
| Reference Data | |
| RefSeq | NP_006539 |
| RefSeq Size | 3676 |
| RefSeq ORF | 1794 |
| Synonyms | IMP-2; IMP2; VICKZ2 |
| Locus ID | 10644 |
| UniProt ID | Q9Y6M1 |
| Cytogenetics | 3q27.2 |
| Summary | This gene encodes a protein that binds the 5' UTR of insulin-like growth factor 2 (IGF2) mRNA and regulates its translation. It plays an important role in metabolism and variation in this gene is associated with susceptibility to diabetes. Alternative splicing and promoter usage results in multiple transcript variants. Related pseudogenes are found on several chromosomes. [provided by RefSeq, Sep 2016] |
Write Your Own Review
| FAQs |
| SDS |
| Recombinant Protein Resources |
| SKU | Description | Size | Price | |
|---|---|---|---|---|
| LC401961 | IGF2BP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
| LC423450 | IGF2BP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
| LY401961 | Transient overexpression lysate of insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2), transcript variant 1 | 100 ug |
$436.00
|
|
| LY423450 | Transient overexpression lysate of insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2), transcript variant 2 | 100 ug |
$665.00
|
|
| TP305673 | Recombinant protein of human insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
| TP720863 | Purified recombinant protein of Human insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2), transcript variant 1 | 10 ug |
$330.00
|
|
Related Products
Check items to add to the cart or
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.