FLVCR2 (NM_017791) Human Recombinant Protein

SKU
TP305665
Recombinant protein of human feline leukemia virus subgroup C cellular receptor family, member 2 (FLVCR2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205665 protein sequence
Red=Cloning site Green=Tags(s)

MVNEGPNQEESDDTPVPESALQADPSVSVHPSVSVHPSVSINPSVSVHPSSSAHPSALAQPSGLAHPSSS
GPEDLSVIKVSRRRWAVVLVFSCYSMCNSFQWIQYGSINNIFMHFYGVSAFAIDWLSMCYMLTYIPLLLP
VAWLLEKFGLRTIALTGSALNCLGAWVKLGSLKPHLFPVTVVGQLICSVAQVFILGMPSRIASVWFGANE
VSTACSVAVFGNQLGIAIGFLVPPVLVPNIEDRDELAYHISIMFYIIGGVATLLLILVIIVFKEKPKYPP
SRAQSLSYALTSPDASYLGSIARLFKNLNFVLLVITYGLNAGAFYALSTLLNRMVIWHYPGEEVNAGRIG
LTIVIAGMLGAVISGIWLDRSKTYKETTLVVYIMTLVGMVVYTFTLNLGHLWVVFITAGTMGFFMTGYLP
LGFEFAVELTYPESEGISSGLLNISAQVFGIIFTISQGQIIDNYGTKPGNIFLCVFLTLGAALTAFIKAD
LRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 57.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060261
Locus ID 55640
UniProt ID Q9UPI3
Cytogenetics 14q24.3
RefSeq Size 3669
RefSeq ORF 1578
Synonyms C14orf58; CCT; EPV; FLVCRL14q; MFSD7C; PVHH; SLC49A2
Summary This gene encodes a member of the major facilitator superfamily. The encoded transmembrane protein is a calcium transporter. Unlike the related protein feline leukemia virus subgroup C receptor 1, the protein encoded by this locus does not bind to feline leukemia virus subgroup C envelope protein. The encoded protein may play a role in development of brain vascular endothelial cells, as mutations at this locus have been associated with proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome. Alternatively spliced transcript variants have been described.[provided by RefSeq, Aug 2010]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:FLVCR2 (NM_017791) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305665 FLVCR2 MS Standard C13 and N15-labeled recombinant protein (NP_060261) 10 ug
$3,255.00
LC413533 FLVCR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434160 FLVCR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413533 Transient overexpression lysate of feline leukemia virus subgroup C cellular receptor family, member 2 (FLVCR2) 100 ug
$436.00
LY434160 Transient overexpression lysate of feline leukemia virus subgroup C cellular receptor family, member 2 (FLVCR2), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.