FLVCR2 (NM_017791) Human Mass Spec Standard

SKU
PH305665
FLVCR2 MS Standard C13 and N15-labeled recombinant protein (NP_060261)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205665]
Predicted MW 57.2 kDa
Protein Sequence
Protein Sequence
>RC205665 protein sequence
Red=Cloning site Green=Tags(s)

MVNEGPNQEESDDTPVPESALQADPSVSVHPSVSVHPSVSINPSVSVHPSSSAHPSALAQPSGLAHPSSS
GPEDLSVIKVSRRRWAVVLVFSCYSMCNSFQWIQYGSINNIFMHFYGVSAFAIDWLSMCYMLTYIPLLLP
VAWLLEKFGLRTIALTGSALNCLGAWVKLGSLKPHLFPVTVVGQLICSVAQVFILGMPSRIASVWFGANE
VSTACSVAVFGNQLGIAIGFLVPPVLVPNIEDRDELAYHISIMFYIIGGVATLLLILVIIVFKEKPKYPP
SRAQSLSYALTSPDASYLGSIARLFKNLNFVLLVITYGLNAGAFYALSTLLNRMVIWHYPGEEVNAGRIG
LTIVIAGMLGAVISGIWLDRSKTYKETTLVVYIMTLVGMVVYTFTLNLGHLWVVFITAGTMGFFMTGYLP
LGFEFAVELTYPESEGISSGLLNISAQVFGIIFTISQGQIIDNYGTKPGNIFLCVFLTLGAALTAFIKAD
LRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060261
RefSeq Size 3669
RefSeq ORF 1578
Synonyms C14orf58; CCT; EPV; FLVCRL14q; MFSD7C; PVHH; SLC49A2
Locus ID 55640
UniProt ID Q9UPI3
Cytogenetics 14q24.3
Summary This gene encodes a member of the major facilitator superfamily. The encoded transmembrane protein is a calcium transporter. Unlike the related protein feline leukemia virus subgroup C receptor 1, the protein encoded by this locus does not bind to feline leukemia virus subgroup C envelope protein. The encoded protein may play a role in development of brain vascular endothelial cells, as mutations at this locus have been associated with proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome. Alternatively spliced transcript variants have been described.[provided by RefSeq, Aug 2010]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:FLVCR2 (NM_017791) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413533 FLVCR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434160 FLVCR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413533 Transient overexpression lysate of feline leukemia virus subgroup C cellular receptor family, member 2 (FLVCR2) 100 ug
$436.00
LY434160 Transient overexpression lysate of feline leukemia virus subgroup C cellular receptor family, member 2 (FLVCR2), transcript variant 2 100 ug
$436.00
TP305665 Recombinant protein of human feline leukemia virus subgroup C cellular receptor family, member 2 (FLVCR2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.