CDC25C (NM_001790) Human Recombinant Protein
SKU
TP305641
Recombinant protein of human cell division cycle 25 homolog C (S. pombe) (CDC25C), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC205641 protein sequence
Red=Cloning site Green=Tags(s) MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKC CLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRK RDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSG LYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQG HLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQ EELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001781 |
Locus ID | 995 |
UniProt ID | P30307 |
Cytogenetics | 5q31.2 |
RefSeq Size | 2191 |
RefSeq ORF | 1419 |
Synonyms | CDC25; PPP1R60 |
Summary | This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome, Phosphatase, Stem cell - Pluripotency |
Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH305641 | CDC25C MS Standard C13 and N15-labeled recombinant protein (NP_001781) | 10 ug |
$3,255.00
|
|
LC411554 | CDC25C HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419747 | CDC25C HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429706 | CDC25C HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY411554 | Transient overexpression lysate of cell division cycle 25 homolog C (S. pombe) (CDC25C), transcript variant 2 | 100 ug |
$436.00
|
|
LY419747 | Transient overexpression lysate of cell division cycle 25 homolog C (S. pombe) (CDC25C), transcript variant 1 | 100 ug |
$436.00
|
|
LY429706 | Transient overexpression lysate of cell division cycle 25 homolog C (S. pombe) (CDC25C), transcript variant 2 | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.