OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDC25C (NM_001790) Human Mass Spec Standard

Be the first to review this product
SKU
PH305641
CDC25C MS Standard C13 and N15-labeled recombinant protein (NP_001781)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY419747 Transient overexpression lysate of cell division cycle 25 homolog C (S. pombe) (CDC25C), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CDC25C or NM_001790"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205641
Predicted MW 53.3 kDa
Protein Sequence
Protein Sequence
>RC205641 protein sequence
Red=Cloning site Green=Tags(s)

MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKC
CLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRK
RDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSG
LYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQG
HLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQ
EELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001781
RefSeq Size 2191
RefSeq ORF 1419
Synonyms CDC25; PPP1R60
Locus ID 995
UniProt ID P30307
Cytogenetics 5q31.2
Summary This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described. provided by RefSeq, Dec 2015
Protein Families Druggable Genome, Phosphatase, Stem cell - Pluripotency
Protein Pathways Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CDC25C" proteins (7)
SKU Description Size Price
LC411554 Lyophilized CDC25C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419747 Lyophilized CDC25C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429706 Lyophilized CDC25C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411554 Transient overexpression lysate of cell division cycle 25 homolog C (S. pombe) (CDC25C), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY419747 Transient overexpression lysate of cell division cycle 25 homolog C (S. pombe) (CDC25C), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY429706 Transient overexpression lysate of cell division cycle 25 homolog C (S. pombe) (CDC25C), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP305641 Recombinant protein of human cell division cycle 25 homolog C (S. pombe) (CDC25C), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products