PEA15 (NM_003768) Human Recombinant Protein

SKU TP305507

Recombinant protein of human phosphoprotein enriched in astrocytes 15 (PEA15), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205507 protein sequence; Red=Cloning site Green=Tags(s); ; MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEIS; RRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003759
• Locus ID: 8682
• UniProt ID: Q15121
• Cytogenetics: 1q23.2
• RefSeq Size: 2509
• RefSeq ORF: 390
• Synonyms: HMAT1; HUMMAT1H; MAT1; MAT1H; PEA-15; PED; PED-PEA15; PED/PEA15
• Summary: This gene encodes a death effector domain-containing protein that functions as a negative regulator of apoptosis. The encoded protein is an endogenous substrate for protein kinase C. This protein is also overexpressed in type 2 diabetes mellitus, where it may contribute to insulin resistance in glucose uptake. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Protein Families: Druggable Genome