OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PEA15 (NM_003768) Human Mass Spec Standard

Be the first to review this product
SKU
PH305507
PEA15 MS Standard C13 and N15-labeled recombinant protein (NP_003759)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350275 Rabbit Polyclonal Anti-PEA15 Antibody
100 ul
$205.00
LY401240 Transient overexpression lysate of phosphoprotein enriched in astrocytes 15 (PEA15) (as WB positive control) 100 ug
$436.00

Other products for "PEA15 or NM_003768"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205507
Predicted MW 15 kDa
Protein Sequence
Protein Sequence
>RC205507 protein sequence
Red=Cloning site Green=Tags(s)

MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEIS
RRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003759
RefSeq Size 2509
RefSeq ORF 390
Synonyms HMAT1; HUMMAT1H; MAT1; MAT1H; PEA-15; PED; PED-PEA15; PED/PEA15
Locus ID 8682
UniProt ID Q15121
Cytogenetics 1q23.2
Summary This gene encodes a death effector domain-containing protein that functions as a negative regulator of apoptosis. The encoded protein is an endogenous substrate for protein kinase C. This protein is also overexpressed in type 2 diabetes mellitus, where it may contribute to insulin resistance in glucose uptake. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2014
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PEA15" proteins (4)
SKU Description Size Price
LC401240 Lyophilized PEA15 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401240 Transient overexpression lysate of phosphoprotein enriched in astrocytes 15 (PEA15) (as WB positive control) 100 ug
$436.00
TP305507 Recombinant protein of human phosphoprotein enriched in astrocytes 15 (PEA15), 20 µg 20 ug
$867.00
TP720922 Purified recombinant protein of Human phosphoprotein enriched in astrocytes 15 (PEA15) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products