AGXT2L1 (ETNPPL) (NM_031279) Human Recombinant Protein

SKU
TP305429
Recombinant protein of human alanine-glyoxylate aminotransferase 2-like 1 (AGXT2L1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205429 protein sequence
Red=Cloning site Green=Tags(s)

MCELYSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAHVGHCHPGVVKAA
LKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYH
GHLSSLIEISPYKFQKGKDVKKEFVHVAPTPDTYRGKYREDHADSASAYADEVKKIIEDAHNSGRKIAAF
IAESMQSCGGQIIPPAGYFQKVAEYVHGAGGVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPM
GNGHPVACVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQ
KAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEE
DAKFMVDQLDRILTVLEEAMGTKTESVTSENTPCKTKMLKEAHIELLRDSTTDSKENPSRKRNGMCTDTH
SLLSKRLKT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_112569
Locus ID 64850
UniProt ID Q8TBG4
Cytogenetics 4q25
RefSeq Size 2133
RefSeq ORF 1497
Synonyms AGXT2L1
Summary Catalyzes the pyridoxal-phosphate-dependent breakdown of phosphoethanolamine, converting it to ammonia, inorganic phosphate and acetaldehyde.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:AGXT2L1 (ETNPPL) (NM_031279) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305429 AGXT2L1 MS Standard C13 and N15-labeled recombinant protein (NP_112569) 10 ug
$3,255.00
LC410615 ETNPPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431381 ETNPPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431436 ETNPPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410615 Transient overexpression lysate of alanine-glyoxylate aminotransferase 2-like 1 (AGXT2L1), transcript variant 1 100 ug
$436.00
LY431381 Transient overexpression lysate of alanine-glyoxylate aminotransferase 2-like 1 (AGXT2L1), transcript variant 3 100 ug
$436.00
LY431436 Transient overexpression lysate of alanine-glyoxylate aminotransferase 2-like 1 (AGXT2L1), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.