AGXT2L1 (ETNPPL) (NM_031279) Human Mass Spec Standard

SKU
PH305429
AGXT2L1 MS Standard C13 and N15-labeled recombinant protein (NP_112569)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205429]
Predicted MW 55.7 kDa
Protein Sequence
Protein Sequence
>RC205429 protein sequence
Red=Cloning site Green=Tags(s)

MCELYSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAHVGHCHPGVVKAA
LKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYH
GHLSSLIEISPYKFQKGKDVKKEFVHVAPTPDTYRGKYREDHADSASAYADEVKKIIEDAHNSGRKIAAF
IAESMQSCGGQIIPPAGYFQKVAEYVHGAGGVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPM
GNGHPVACVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQ
KAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEE
DAKFMVDQLDRILTVLEEAMGTKTESVTSENTPCKTKMLKEAHIELLRDSTTDSKENPSRKRNGMCTDTH
SLLSKRLKT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112569
RefSeq Size 2133
RefSeq ORF 1497
Synonyms AGXT2L1
Locus ID 64850
UniProt ID Q8TBG4
Cytogenetics 4q25
Summary Catalyzes the pyridoxal-phosphate-dependent breakdown of phosphoethanolamine, converting it to ammonia, inorganic phosphate and acetaldehyde.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:AGXT2L1 (ETNPPL) (NM_031279) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410615 ETNPPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431381 ETNPPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431436 ETNPPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410615 Transient overexpression lysate of alanine-glyoxylate aminotransferase 2-like 1 (AGXT2L1), transcript variant 1 100 ug
$436.00
LY431381 Transient overexpression lysate of alanine-glyoxylate aminotransferase 2-like 1 (AGXT2L1), transcript variant 3 100 ug
$436.00
LY431436 Transient overexpression lysate of alanine-glyoxylate aminotransferase 2-like 1 (AGXT2L1), transcript variant 2 100 ug
$436.00
TP305429 Recombinant protein of human alanine-glyoxylate aminotransferase 2-like 1 (AGXT2L1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.