Calponin (CNN1) (NM_001299) Human Recombinant Protein

SKU
TP305370
Recombinant protein of human calponin 1, basic, smooth muscle (CNN1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205370 protein sequence
Red=Cloning site Green=Tags(s)

MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIILCEFINKLQPG
SVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNV
GVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTDQPLDQATISLQMGT
NKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPE
LGEPAHNHHAHNYYNSA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001290
Locus ID 1264
UniProt ID P51911
Cytogenetics 19p13.2
RefSeq Size 1599
RefSeq ORF 891
Synonyms HEL-S-14; Sm-Calp; SMCC
Summary Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Calponin (CNN1) (NM_001299) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305370 CNN1 MS Standard C13 and N15-labeled recombinant protein (NP_001290) 10 ug
$3,255.00
LC400519 CNN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400519 Transient overexpression lysate of calponin 1, basic, smooth muscle (CNN1) 100 ug
$436.00
TP762396 Purified recombinant protein of Human calponin 1, basic, smooth muscle (CNN1), Leu67-Gly257, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.