Calponin (CNN1) (NM_001299) Human Mass Spec Standard

SKU
PH305370
CNN1 MS Standard C13 and N15-labeled recombinant protein (NP_001290)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205370]
Predicted MW 33.2 kDa
Protein Sequence
Protein Sequence
>RC205370 protein sequence
Red=Cloning site Green=Tags(s)

MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIILCEFINKLQPG
SVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNV
GVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTDQPLDQATISLQMGT
NKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPE
LGEPAHNHHAHNYYNSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001290
RefSeq Size 1599
RefSeq ORF 891
Synonyms HEL-S-14; Sm-Calp; SMCC
Locus ID 1264
UniProt ID P51911
Cytogenetics 19p13.2
Summary Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Calponin (CNN1) (NM_001299) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400519 CNN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400519 Transient overexpression lysate of calponin 1, basic, smooth muscle (CNN1) 100 ug
$436.00
TP305370 Recombinant protein of human calponin 1, basic, smooth muscle (CNN1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP762396 Purified recombinant protein of Human calponin 1, basic, smooth muscle (CNN1), Leu67-Gly257, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.