FACL4 (ACSL4) (NM_004458) Human Recombinant Protein
CAT#: TP305356
Recombinant protein of human acyl-CoA synthetase long-chain family member 4 (ACSL4), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205356 protein sequence
Red=Cloning site Green=Tags(s) MAKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPN GKVFKKLILGNYKWMNYLEVNRRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTLY ATLGKEAVVHGLNESEASYLITSVELLESKLKTALLDISCVKHIIYVDNKAINKAEYPEGFEIHSMQSVE ELGSNPENLGIPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERIPGLGPKDTYIGYLPL AHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQE MNYIQKTLFKIGYDYKLEQIKKGYDAPLCNLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCP IGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYF KNEEKTAEDYSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNI CAFAKSDQSYVISFVVPNQKRLTLLAQQKGVEGTWVDICNNPAMEAEILKEIREAANAMKLERFEIPIKV RLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMYGGK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 74.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004449 |
Locus ID | 2182 |
UniProt ID | O60488 |
Cytogenetics | Xq23 |
Refseq Size | 5039 |
Refseq ORF | 2010 |
Synonyms | ACS4; FACL4; LACS4; MRX63; MRX68 |
Summary | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the cognitive disability or Alport syndrome. Alternative splicing of this gene generates multiple transcript variants. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401417 | ACSL4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC411426 | ACSL4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY401417 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 4 (ACSL4), transcript variant 1 |
USD 436.00 |
|
LY411426 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 4 (ACSL4), transcript variant 2 |
USD 665.00 |
|
PH305356 | ACSL4 MS Standard C13 and N15-labeled recombinant protein (NP_004449) |
USD 3,255.00 |
|
PH321413 | ACSL4 MS Standard C13 and N15-labeled recombinant protein (NP_075266) |
USD 3,255.00 |
|
TP321413 | Recombinant protein of human acyl-CoA synthetase long-chain family member 4 (ACSL4), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review