FACL4 (ACSL4) (NM_022977) Human Mass Spec Standard

SKU
PH321413
ACSL4 MS Standard C13 and N15-labeled recombinant protein (NP_075266)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221413]
Predicted MW 79 kDa
Protein Sequence
Protein Sequence
>RC221413 representing NM_022977
Red=Cloning site Green=Tags(s)

MKLKLNVLTIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKPGSPYRSVTHFDSLAV
IDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWMNYLEVNRRVNNFGS
GLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSVELLES
KLKTALLDISCVKHIIYVDNKAINKAEYPEGFEIHSMQSVEELGSNPENLGIPPSRPTPSDMAIVMYTSG
STGRPKGVMMHHSNLIAGMTGQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSD
QSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLC
NLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGA
PLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFH
PDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKRLTLLAQQK
GVEGTWVDICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHY
LKDIERMYGGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_075266
RefSeq Size 5356
RefSeq ORF 2133
Synonyms ACS4; FACL4; LACS4; MRX63; MRX68
Locus ID 2182
UniProt ID O60488
Cytogenetics Xq23
Summary The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the cognitive disability or Alport syndrome. Alternative splicing of this gene generates multiple transcript variants. [provided by RefSeq, Jan 2016]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway
Write Your Own Review
You're reviewing:FACL4 (ACSL4) (NM_022977) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305356 ACSL4 MS Standard C13 and N15-labeled recombinant protein (NP_004449) 10 ug
$3,255.00
LC401417 ACSL4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411426 ACSL4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401417 Transient overexpression lysate of acyl-CoA synthetase long-chain family member 4 (ACSL4), transcript variant 1 100 ug
$436.00
LY411426 Transient overexpression lysate of acyl-CoA synthetase long-chain family member 4 (ACSL4), transcript variant 2 100 ug
$665.00
TP305356 Recombinant protein of human acyl-CoA synthetase long-chain family member 4 (ACSL4), transcript variant 1, 20 µg 20 ug
$867.00
TP321413 Recombinant protein of human acyl-CoA synthetase long-chain family member 4 (ACSL4), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.