OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VILIP1 (VSNL1) (NM_003385) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP305337
Recombinant protein of human visinin-like 1 (VSNL1), 20 µg
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA801897 VSNL1 mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)
100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "VILIP1 or NM_003385"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205337 protein sequence
Red=Cloning site Green=Tags(s)

MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFR
TFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKM
NEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity WB positive control (PMID: 29283288)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003376
Locus ID 7447
UniProt ID P62760
Cytogenetics 2p24.2
RefSeq Size 2014
RefSeq ORF 573
Synonyms HLP3; HPCAL3; HUVISL1; VILIP; VILIP-1
Summary This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VILIP1" proteins (4)
SKU Description Size Price
PH305337 VSNL1 MS Standard C13 and N15-labeled recombinant protein (NP_003376) 10 ug
$3,360.00
LC418720 Lyophilized VSNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418720 Transient overexpression lysate of visinin-like 1 (VSNL1) (as WB positive control) 100 ug
$436.00
TP720237 Recombinant protein of human visinin-like 1 (VSNL1) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products