VILIP1 (VSNL1) (NM_003385) Human Mass Spec Standard

SKU
PH305337
VSNL1 MS Standard C13 and N15-labeled recombinant protein (NP_003376)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205337]
Predicted MW 22.1 kDa
Protein Sequence
Protein Sequence
>RC205337 protein sequence
Red=Cloning site Green=Tags(s)

MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFR
TFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKM
NEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003376
RefSeq Size 2014
RefSeq ORF 573
Synonyms HLP3; HPCAL3; HUVISL1; VILIP; VILIP-1
Locus ID 7447
UniProt ID P62760
Cytogenetics 2p24.2
Summary This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:VILIP1 (VSNL1) (NM_003385) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418720 VSNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418720 Transient overexpression lysate of visinin-like 1 (VSNL1) 100 ug
$436.00
TP305337 Recombinant protein of human visinin-like 1 (VSNL1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720237 Recombinant protein of human visinin-like 1 (VSNL1) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.