RASL10A (NM_006477) Human Recombinant Protein

SKU
TP305271
Recombinant protein of human RAS-like, family 10, member A (RASL10A), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205271 protein sequence
Red=Cloning site Green=Tags(s)

MGGSLRVAVLGAPGVGKTAIIRQFVFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPG
GPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILVVGNKRDRQRLRFGP
RRALAALVRRGWRCGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006468
Locus ID 10633
UniProt ID Q92737
Cytogenetics 22q12.2
RefSeq Size 1504
RefSeq ORF 609
Synonyms RRP22
Summary Potent inhibitor of cellular proliferation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RASL10A (NM_006477) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305271 RASL10A MS Standard C13 and N15-labeled recombinant protein (NP_006468) 10 ug
$3,255.00
PH308743 RASL10A MS Standard C13 and N15-labeled recombinant protein (NP_001007280) 10 ug
$3,255.00
LC416619 RASL10A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423485 RASL10A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416619 Transient overexpression lysate of RAS-like, family 10, member A (RASL10A), transcript variant 1 100 ug
$436.00
LY423485 Transient overexpression lysate of RAS-like, family 10, member A (RASL10A), transcript variant 2 100 ug
$436.00
TP308743 Recombinant protein of human RAS-like, family 10, member A (RASL10A), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.