RASL10A (NM_001007279) Human Mass Spec Standard

SKU
PH308743
RASL10A MS Standard C13 and N15-labeled recombinant protein (NP_001007280)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208743]
Predicted MW 12.5 kDa
Protein Sequence
Protein Sequence
>RC208743 protein sequence
Red=Cloning site Green=Tags(s)

MGGSLRVAVLGAPGVGKTAIIRQFLFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPG
GPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001007280
RefSeq Size 1813
RefSeq ORF 345
Synonyms RRP22
Locus ID 10633
UniProt ID Q92737
Cytogenetics 22q12.2
Summary Potent inhibitor of cellular proliferation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RASL10A (NM_001007279) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305271 RASL10A MS Standard C13 and N15-labeled recombinant protein (NP_006468) 10 ug
$3,255.00
LC416619 RASL10A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423485 RASL10A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416619 Transient overexpression lysate of RAS-like, family 10, member A (RASL10A), transcript variant 1 100 ug
$436.00
LY423485 Transient overexpression lysate of RAS-like, family 10, member A (RASL10A), transcript variant 2 100 ug
$436.00
TP305271 Recombinant protein of human RAS-like, family 10, member A (RASL10A), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP308743 Recombinant protein of human RAS-like, family 10, member A (RASL10A), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.