Parvin alpha (PARVA) (NM_018222) Human Recombinant Protein

SKU
TP305086
Recombinant protein of human parvin, alpha (PARVA), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205086 protein sequence
Red=Cloning site Green=Tags(s)

MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDP
EDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEK
LNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDH
VSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLN
LEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIV
NCDLKSTLRVLYNLFTKYRNVE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 42.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060692
Locus ID 55742
UniProt ID Q9NVD7
Cytogenetics 11p15.3
RefSeq Size 8719
RefSeq ORF 1116
Synonyms CH-ILKBP; MXRA2
Summary This gene encodes a member of the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival. [provided by RefSeq, Dec 2010]
Protein Pathways Focal adhesion
Write Your Own Review
You're reviewing:Parvin alpha (PARVA) (NM_018222) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305086 PARVA MS Standard C13 and N15-labeled recombinant protein (NP_060692) 10 ug
$3,255.00
LC413202 PARVA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413202 Transient overexpression lysate of parvin, alpha (PARVA) 100 ug
$436.00
TP720856 Purified recombinant protein of Human parvin, alpha (PARVA) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.