Parvin alpha (PARVA) (NM_018222) Human Mass Spec Standard

SKU
PH305086
PARVA MS Standard C13 and N15-labeled recombinant protein (NP_060692)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205086]
Predicted MW 42.2 kDa
Protein Sequence
Protein Sequence
>RC205086 protein sequence
Red=Cloning site Green=Tags(s)

MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDP
EDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEK
LNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDH
VSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLN
LEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIV
NCDLKSTLRVLYNLFTKYRNVE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060692
RefSeq Size 8719
RefSeq ORF 1116
Synonyms CH-ILKBP; MXRA2
Locus ID 55742
UniProt ID Q9NVD7
Cytogenetics 11p15.3
Summary This gene encodes a member of the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival. [provided by RefSeq, Dec 2010]
Protein Pathways Focal adhesion
Write Your Own Review
You're reviewing:Parvin alpha (PARVA) (NM_018222) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413202 PARVA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413202 Transient overexpression lysate of parvin, alpha (PARVA) 100 ug
$436.00
TP305086 Recombinant protein of human parvin, alpha (PARVA), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720856 Purified recombinant protein of Human parvin, alpha (PARVA) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.