PPP1R1C (NM_001080545) Human Recombinant Protein

SKU
TP305047
Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205047 protein sequence
Red=Cloning site Green=Tags(s)

MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRK
QSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 12.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001074014
Locus ID 151242
UniProt ID Q8WVI7
Cytogenetics 2q31.3-q32.1
RefSeq Size 1078
RefSeq ORF 327
Synonyms IPP5
Summary Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit (see PPP1CA; MIM 176875) and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation (Wang et al., 2008 [PubMed 18310074]).[supplied by OMIM, Feb 2010]
Protein Families Druggable Genome, Phosphatase
Write Your Own Review
You're reviewing:PPP1R1C (NM_001080545) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305047 PPP1R1C MS Standard C13 and N15-labeled recombinant protein (NP_001074014) 10 ug
$3,255.00
LC421099 PPP1R1C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421099 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.