PPP1R1C (NM_001080545) Human Mass Spec Standard

SKU PH305047

PPP1R1C MS Standard C13 and N15-labeled recombinant protein (NP_001074014)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC205047]
• Predicted MW: 12.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC205047 protein sequence; Red=Cloning site Green=Tags(s); ; MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRK; QSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001074014
• RefSeq Size: 1078
• RefSeq ORF: 327
• Synonyms: IPP5
• Locus ID: 151242
• UniProt ID: Q8WVI7
• Cytogenetics: 2q31.3-q32.1
• Summary: Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit (see PPP1CA; MIM 176875) and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation (Wang et al., 2008 [PubMed 18310074]).[supplied by OMIM, Feb 2010]
• Protein Families: Druggable Genome, Phosphatase