TPST2 (NM_001008566) Human Recombinant Protein

SKU
TP304969
Recombinant protein of human tyrosylprotein sulfotransferase 2 (TPST2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204969 protein sequence
Red=Cloning site Green=Tags(s)

MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPL
IFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAF
ILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDC
LTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLS
KIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLK
GDYKTPANLKGYFQVNQNSTSSHLGSS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001008566
Locus ID 8459
UniProt ID O60704
Cytogenetics 22q12.1
RefSeq Size 2018
RefSeq ORF 1131
Synonyms TANGO13B; TPST-2
Summary The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Alternative splicing produces multiple transcript variants encoding distinct isoforms. [provided by RefSeq, May 2018]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:TPST2 (NM_001008566) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304969 TPST2 MS Standard C13 and N15-labeled recombinant protein (NP_001008566) 10 ug
$3,255.00
LC418564 TPST2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423338 TPST2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418564 Transient overexpression lysate of tyrosylprotein sulfotransferase 2 (TPST2), transcript variant 2 100 ug
$436.00
LY423338 Transient overexpression lysate of tyrosylprotein sulfotransferase 2 (TPST2), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.