TPST2 (NM_001008566) Human Mass Spec Standard

SKU
PH304969
TPST2 MS Standard C13 and N15-labeled recombinant protein (NP_001008566)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204969]
Predicted MW 41.9 kDa
Protein Sequence
Protein Sequence
>RC204969 protein sequence
Red=Cloning site Green=Tags(s)

MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPL
IFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAF
ILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDC
LTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLS
KIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLK
GDYKTPANLKGYFQVNQNSTSSHLGSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001008566
RefSeq Size 2018
RefSeq ORF 1131
Synonyms TANGO13B; TPST-2
Locus ID 8459
UniProt ID O60704
Cytogenetics 22q12.1
Summary The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Alternative splicing produces multiple transcript variants encoding distinct isoforms. [provided by RefSeq, May 2018]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:TPST2 (NM_001008566) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418564 TPST2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423338 TPST2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418564 Transient overexpression lysate of tyrosylprotein sulfotransferase 2 (TPST2), transcript variant 2 100 ug
$436.00
LY423338 Transient overexpression lysate of tyrosylprotein sulfotransferase 2 (TPST2), transcript variant 1 100 ug
$436.00
TP304969 Recombinant protein of human tyrosylprotein sulfotransferase 2 (TPST2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.