LAGE3 (NM_006014) Human Recombinant Protein

SKU
TP304863
Purified recombinant protein of Homo sapiens L antigen family, member 3 (LAGE3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204863 protein sequence
Red=Cloning site Green=Tags(s)

MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFP
TPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPP
VSR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006005
Locus ID 8270
UniProt ID Q14657
Cytogenetics Xq28
RefSeq Size 964
RefSeq ORF 429
Synonyms CVG5; DXS9879E; DXS9951E; ESO3; GAMOS2; ITBA2; Pcc1
Summary This gene belongs to the ESO/LAGE gene family, members of which are clustered together on chromosome Xq28, and have similar exon-intron structures. Unlike the other family members which are normally expressed only in testis and activated in a wide range of human tumors, this gene is ubiquitously expressed in somatic tissues. The latter, combined with the finding that it is highly conserved in mouse and rat, suggests that the encoded protein is functionally important. An intronless pseudogene with high sequence similarity to this gene is located on chromosome 9. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:LAGE3 (NM_006014) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304863 LAGE3 MS Standard C13 and N15-labeled recombinant protein (NP_006005) 10 ug
$3,255.00
LC401824 LAGE3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401824 Transient overexpression lysate of L antigen family, member 3 (LAGE3) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.