OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LAGE3 (NM_006014) Human Mass Spec Standard

Be the first to review this product
SKU
PH304863
LAGE3 MS Standard C13 and N15-labeled recombinant protein (NP_006005)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337406 Rabbit Polyclonal Anti-LAGE3 Antibody
100 ul
$585.00
LY401824 Transient overexpression lysate of L antigen family, member 3 (LAGE3) (as WB positive control) 100 ug
$436.00

Other products for "LAGE3 or NM_006014"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204863
Predicted MW 14.8 kDa
Protein Sequence
Protein Sequence
>RC204863 protein sequence
Red=Cloning site Green=Tags(s)

MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFP
TPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPP
VSR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006005
RefSeq Size 964
RefSeq ORF 429
Synonyms CVG5; DXS9879E; DXS9951E; ESO3; GAMOS2; ITBA2; Pcc1
Locus ID 8270
UniProt ID Q14657
Cytogenetics Xq28
Summary This gene belongs to the ESO/LAGE gene family, members of which are clustered together on chromosome Xq28, and have similar exon-intron structures. Unlike the other family members which are normally expressed only in testis and activated in a wide range of human tumors, this gene is ubiquitously expressed in somatic tissues. The latter, combined with the finding that it is highly conserved in mouse and rat, suggests that the encoded protein is functionally important. An intronless pseudogene with high sequence similarity to this gene is located on chromosome 9. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LAGE3" proteins (3)
SKU Description Size Price
LC401824 Lyophilized LAGE3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401824 Transient overexpression lysate of L antigen family, member 3 (LAGE3) (as WB positive control) 100 ug
$436.00
TP304863 Purified recombinant protein of Homo sapiens L antigen family, member 3 (LAGE3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products