UBE1C (UBA3) (NM_003968) Human Recombinant Protein

SKU
TP304675
Recombinant protein of human ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204675 representing NM_003968
Red=Cloning site Green=Tags(s)

MADGEEPERKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTC
KVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCN
VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNA
RVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQW
IFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDG
LYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTS
IEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003959
Locus ID 9039
UniProt ID Q8TBC4
Cytogenetics 3p14.1
RefSeq Size 2136
RefSeq ORF 1389
Synonyms hUBA3; NAE2; UBE1C
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:UBE1C (UBA3) (NM_003968) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304675 UBA3 MS Standard C13 and N15-labeled recombinant protein (NP_003959) 10 ug
$3,255.00
PH316801 UBA3 MS Standard C13 and N15-labeled recombinant protein (NP_937838) 10 ug
$3,255.00
LC404973 UBA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418315 UBA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404973 Transient overexpression lysate of ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 2 100 ug
$665.00
LY418315 Transient overexpression lysate of ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 1 100 ug
$436.00
TP316801 Recombinant protein of human ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.