UBE1C (UBA3) (NM_198195) Human Mass Spec Standard

SKU
PH316801
UBA3 MS Standard C13 and N15-labeled recombinant protein (NP_937838)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216801]
Predicted MW 49.9 kDa
Protein Sequence
Protein Sequence
>RC216801 representing NM_198195
Red=Cloning site Green=Tags(s)

MADGEEPMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCEL
LKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDT
FYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECT
LELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNI
RGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENC
PACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLSKTLK
ELGLVDGQELAVADVTTPQTVLFKLHFTS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_937838
RefSeq Size 2094
RefSeq ORF 1347
Synonyms hUBA3; NAE2; UBE1C
Locus ID 9039
UniProt ID Q8TBC4
Cytogenetics 3p14.1
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:UBE1C (UBA3) (NM_198195) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304675 UBA3 MS Standard C13 and N15-labeled recombinant protein (NP_003959) 10 ug
$3,255.00
LC404973 UBA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418315 UBA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404973 Transient overexpression lysate of ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 2 100 ug
$665.00
LY418315 Transient overexpression lysate of ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 1 100 ug
$436.00
TP304675 Recombinant protein of human ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316801 Recombinant protein of human ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.