SNAIL (SNAI1) (NM_005985) Human Recombinant Protein

SKU
TP304581
Recombinant protein of human snail homolog 1 (Drosophila) (SNAI1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204581 representing NM_005985
Red=Cloning site Green=Tags(s)

MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQ
PIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLA
QLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSC
PHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 28.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005976
Locus ID 6615
UniProt ID O95863
Cytogenetics 20q13.13
RefSeq Size 1708
RefSeq ORF 792
Synonyms dJ710H13.1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1
Summary The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Adherens junction
Write Your Own Review
You're reviewing:SNAIL (SNAI1) (NM_005985) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304581 SNAI1 MS Standard C13 and N15-labeled recombinant protein (NP_005976) 10 ug
$3,255.00
LC401811 SNAI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401811 Transient overexpression lysate of snail homolog 1 (Drosophila) (SNAI1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.