SNAIL (SNAI1) (NM_005985) Human Tagged ORF Clone

SKU
RC204581
SNAI1 (Myc-DDK-tagged)-Human snail homolog 1 (Drosophila) (SNAI1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Target Symbol SNAIL
Synonyms dJ710H13.1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204581 representing NM_005985
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGCGCTCTTTCCTCGTCAGGAAGCCCTCCGACCCCAATCGGAAGCCTAACTACAGCGAGCTGCAGG
ACTCTAATCCAGAGTTTACCTTCCAGCAGCCCTACGACCAGGCCCACCTGCTGGCAGCCATCCCACCTCC
GGAGATCCTCAACCCCACCGCCTCGCTGCCAATGCTCATCTGGGACTCTGTCCTGGCGCCCCAAGCCCAG
CCAATTGCCTGGGCCTCCCTTCGGCTCCAGGAGAGTCCCAGGGTGGCAGAGCTGACCTCCCTGTCAGATG
AGGACAGTGGGAAAGGCTCCCAGCCCCCCAGCCCACCCTCACCGGCTCCTTCGTCCTTCTCCTCTACTTC
AGTCTCTTCCTTGGAGGCCGAGGCCTATGCTGCCTTCCCAGGCTTGGGCCAAGTGCCCAAGCAGCTGGCC
CAGCTCTCTGAGGCCAAGGATCTCCAGGCTCGAAAGGCCTTCAACTGCAAATACTGCAACAAGGAATACC
TCAGCCTGGGTGCCCTCAAGATGCACATCCGAAGCCACACGCTGCCCTGCGTCTGCGGAACCTGCGGGAA
GGCCTTCTCTAGGCCCTGGCTGCTACAAGGCCATGTCCGGACCCACACTGGCGAGAAGCCCTTCTCCTGT
CCCCACTGCAGCCGTGCCTTCGCTGACCGCTCCAACCTGCGGGCCCACCTCCAGACCCACTCAGATGTCA
AGAAGTACCAGTGCCAGGCGTGTGCTCGGACCTTCTCCCGAATGTCCCTGCTCCACAAGCACCAAGAGTC
CGGCTGCTCAGGATGTCCCCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204581 representing NM_005985
Red=Cloning site Green=Tags(s)

MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQ
PIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLA
QLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSC
PHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005985
ORF Size 792 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005985.4
RefSeq Size 1708 bp
RefSeq ORF 795 bp
Locus ID 6615
UniProt ID O95863
Cytogenetics 20q13.13
Protein Families Druggable Genome
Protein Pathways Adherens junction
MW 28.9 kDa
Summary The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SNAIL (SNAI1) (NM_005985) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204581L1 Lenti ORF clone of Human snail homolog 1 (Drosophila) (SNAI1), Myc-DDK-tagged 10 ug
$750.00
RC204581L2 Lenti ORF clone of Human snail homolog 1 (Drosophila) (SNAI1), mGFP tagged 10 ug
$750.00
RC204581L3 Lenti ORF clone of Human snail homolog 1 (Drosophila) (SNAI1), Myc-DDK-tagged 10 ug
$750.00
RC204581L4 Lenti ORF clone of Human snail homolog 1 (Drosophila) (SNAI1), mGFP tagged 10 ug
$750.00
RG204581 SNAI1 (tGFP-tagged) - Human snail homolog 1 (Drosophila) (SNAI1) 10 ug
$650.00
SC122733 SNAI1 (untagged)-Human snail homolog 1 (Drosophila) (SNAI1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.