GFAP (NM_002055) Human Recombinant Protein
CAT#: TP304548
Recombinant protein of human glial fibrillary acidic protein (GFAP), transcript variant 1, 20 µg
View other "GFAP" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204548 protein sequence
Red=Cloning site Green=Tags(s) MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASER AEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVE RDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRE LQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKH EANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV IKESKQEHKDVM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.7 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | WB positive control (PMID: 29774780) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002046 |
Locus ID | 2670 |
UniProt ID | P14136 |
Cytogenetics | 17q21.31 |
Refseq Size | 3097 |
Refseq ORF | 1296 |
Synonyms | ALXDRD |
Summary | This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008] |
Protein Families | ES Cell Differentiation/IPS |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419563 | GFAP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427360 | GFAP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419563 | Transient overexpression lysate of glial fibrillary acidic protein (GFAP), transcript variant 1 |
USD 436.00 |
|
LY427360 | Transient overexpression lysate of glial fibrillary acidic protein (GFAP), transcript variant 2 |
USD 436.00 |
|
PH304548 | GFAP MS Standard C13 and N15-labeled recombinant protein (NP_002046) |
USD 3,255.00 |
|
TP762317 | Purified recombinant protein of Human glial fibrillary acidic protein (GFAP), transcript variant 1, Leu292-End, with N-terminal His tag, expressed in E.coli, 50ug |
USD 249.00 |
{0} Product Review(s)
Be the first one to submit a review