GFAP (NM_002055) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC204548] |
Predicted MW | 49.9 kDa |
Protein Sequence |
Protein Sequence
>RC204548 protein sequence
Red=Cloning site Green=Tags(s) MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASER AEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVE RDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRE LQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKH EANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV IKESKQEHKDVM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002046 |
RefSeq Size | 3097 |
RefSeq ORF | 1296 |
Synonyms | ALXDRD |
Locus ID | 2670 |
UniProt ID | P14136 |
Cytogenetics | 17q21.31 |
Summary | This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008] |
Protein Families | ES Cell Differentiation/IPS |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC419563 | GFAP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427360 | GFAP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY419563 | Transient overexpression lysate of glial fibrillary acidic protein (GFAP), transcript variant 1 | 100 ug |
$436.00
|
|
LY427360 | Transient overexpression lysate of glial fibrillary acidic protein (GFAP), transcript variant 2 | 100 ug |
$436.00
|
|
TP304548 | Recombinant protein of human glial fibrillary acidic protein (GFAP), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP762317 | Purified recombinant protein of Human glial fibrillary acidic protein (GFAP), transcript variant 1, Leu292-End, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$249.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.