OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BCL2 (NM_000633) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP304498
Recombinant protein of human B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA806591 BCL2 mouse monoclonal antibody, clone OTI9D3 (formerly 9D3) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "BCL2 or NM_000633"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204498 representing NM_000633
Red=Cloning site Green=Tags(s)

MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTS
PLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD
GVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLF
DFSWLSLKTLLSLALVGACITLGAYLGHK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000624
Locus ID 596
UniProt ID P10415
Cytogenetics 18q21.33
RefSeq Size 6492
RefSeq ORF 717
Synonyms Bcl-2; PPP1R50
Summary This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants. provided by RefSeq, Feb 2016
Protein Categories Cancer: Gynecologic, Cancer: Haematopoietic and Lymphoid, Cancer: Head and Neck, Cancer: Lung, Cancer: Sarcoma, Cytokines, Growth Factors, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Stem cell - Pluripotency, Transmembrane
Protein Pathways Amyotrophic lateral sclerosis (ALS), Apoptosis, Colorectal cancer, Focal adhesion, Neurotrophin signaling pathway, Pathways in cancer, Prostate cancer, Small cell lung cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BCL2" proteins (7)
SKU Description Size Price
PH304498 BCL2 MS Standard C13 and N15-labeled recombinant protein (NP_000624) 10 ug
$3,360.00
LC424584 Lyophilized BCL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424602 Lyophilized BCL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424584 Transient overexpression lysate of B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant beta (as WB positive control) 100 ug
$436.00
LY424602 Transient overexpression lysate of B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha (as WB positive control) 100 ug
$436.00
TP750159 Purified recombinant protein of Human B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha,Met1-Lys218, with C-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00
TP762352 Purified recombinant protein of Human B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha, Gly54-Val66(8 reapeat regions linked with GGGGS), with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00

file-alt Citations

Metaproteomic profiling reveals viral proteins and associated host proteomic alterations in glioblastoma
Gunasegaran, Krishnamurthy, Ahn et al
Sci Rep (2026)
AI Summary: In this study, OriGene products AFMID (TP317126), BCL2 (TP304498), and C1QC (TP761200) recombinant proteins were used to construct a spectral library for metaproteomic analysis of glioblastoma tissues, enabling the identification of viral and host proteomic alterations.
Snippet: The following recombinant proteins were used to construct the DDA recombinant 222 protein spectral library for this study: AADAT (R&D Systems, 7927-AT-010), AFMID 223 (OriGene Technologies, TP317126), BCL2 (OriGene, TP304498), C1QC (OriGene, 224 TP761200), CDX2 (Aviva Systems Biology, OPCD02118),
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products