CD34 (NM_001025109) Human Recombinant Protein
SKU
TP304446
Recombinant protein of human CD34 molecule (CD34), transcript variant 1, 20 µg
$867.00
5 Days*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC204446 protein sequence
Red=Cloning site Green=Tags(s) MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGST SLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSP GNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGL ARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDV ASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQ GKASVNRGAQENGTGQATSRNGHSARQHVVADTEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001020280 |
Locus ID | 947 |
UniProt ID | P28906 |
Cytogenetics | 1q32.2 |
RefSeq Size | 2621 |
RefSeq ORF | 1155 |
Summary | The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Protein Families | Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Hematopoietic cell lineage |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH304446 | CD34 MS Standard C13 and N15-labeled recombinant protein (NP_001020280) | 10 ug |
$3,255.00
|
|
LC400668 | CD34 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422593 | CD34 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400668 | Transient overexpression lysate of CD34 molecule (CD34), transcript variant 2 | 100 ug |
$436.00
|
|
LY422593 | Transient overexpression lysate of CD34 molecule (CD34), transcript variant 1 | 100 ug |
$436.00
|
|
TP700209 | Recombinant protein of human CD34 molecule (CD34), transcript variant 2, extracellular domain with C-terminal Fc fusion, expressed in human cells, 20 µg | 20 ug |
$867.00
|
|
TP724005 | Human CD34 Protein, His Tag | 100 ug |
$565.00
|
|
TP762681 | Purified recombinant protein of Human CD34 molecule (CD34), transcript variant 1, 32Ser-290Thr, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.