CD34 (NM_001025109) Human Mass Spec Standard

SKU
PH304446
CD34 MS Standard C13 and N15-labeled recombinant protein (NP_001020280)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204446]
Predicted MW 40.7 kDa
Protein Sequence
Protein Sequence
>RC204446 protein sequence
Red=Cloning site Green=Tags(s)

MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGST
SLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSP
GNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGL
ARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDV
ASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQ
GKASVNRGAQENGTGQATSRNGHSARQHVVADTEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020280
RefSeq Size 2621
RefSeq ORF 1155
Locus ID 947
UniProt ID P28906
Cytogenetics 1q32.2
Summary The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Protein Families Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Hematopoietic cell lineage
Write Your Own Review
You're reviewing:CD34 (NM_001025109) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400668 CD34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422593 CD34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400668 Transient overexpression lysate of CD34 molecule (CD34), transcript variant 2 100 ug
$436.00
LY422593 Transient overexpression lysate of CD34 molecule (CD34), transcript variant 1 100 ug
$436.00
TP304446 Recombinant protein of human CD34 molecule (CD34), transcript variant 1, 20 µg 20 ug
$867.00
TP700209 Recombinant protein of human CD34 molecule (CD34), transcript variant 2, extracellular domain with C-terminal Fc fusion, expressed in human cells, 20 µg 20 ug
$867.00
TP724005 Human CD34 Protein, His Tag 100 ug
$565.00
TP762681 Purified recombinant protein of Human CD34 molecule (CD34), transcript variant 1, 32Ser-290Thr, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.