OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD34 (NM_001025109) Human Mass Spec Standard

Be the first to review this product
SKU
PH304446
CD34 MS Standard C13 and N15-labeled recombinant protein (NP_001020280)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808885 CD34 mouse monoclonal antibody, clone OTI11E1 (formerly 11E1) 100 ul
$447.00
LY422593 Transient overexpression lysate of CD34 molecule (CD34), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CD34 or NM_001025109"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204446
Predicted MW 40.7 kDa
Protein Sequence
Protein Sequence
>RC204446 protein sequence
Red=Cloning site Green=Tags(s)

MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGST
SLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSP
GNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGL
ARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDV
ASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQ
GKASVNRGAQENGTGQATSRNGHSARQHVVADTEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020280
RefSeq Size 2621
RefSeq ORF 1155
Locus ID 947
UniProt ID P28906
Cytogenetics 1q32.2
Summary The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Aug 2011
Protein Families Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Hematopoietic cell lineage
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD34" proteins (8)
SKU Description Size Price
LC400668 Lyophilized CD34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422593 Lyophilized CD34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400668 Transient overexpression lysate of CD34 molecule (CD34), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422593 Transient overexpression lysate of CD34 molecule (CD34), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP304446 Recombinant protein of human CD34 molecule (CD34), transcript variant 1, 20 µg 20 ug
$867.00
TP700209 Recombinant protein of human CD34 molecule (CD34), transcript variant 2, extracellular domain with C-terminal Fc fusion, expressed in human cells, 20 µg 20 ug
$900.00
TP724005 Recombinant human CD34 protein with C-terminal 6×His tag 100 ug
$695.00
TP762681 Purified recombinant protein of Human CD34 molecule (CD34), transcript variant 1, 32Ser-290Thr, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products